2VEAA

The complete sensory module of the cyanobacterial phytochrome cph1 in the pr-state.
Warning
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K 41 41
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
41 23-271 249 1-22, 272-517 22 246 knot
Chain Sequence
TVQLSDQSLRQLETLAIHTAHLIQPHGLVVVLQEPDLTISQISANCTGILGRSPEDLLGRTLGEVFDSF--------LTAGQISSLNPSKLWARVMDFVIFDGV--FHRNSDGLLVCELEPAYTSDNLPFLGFYHMANAALNRLNLRDFYDVIV----EEVRRMTGFDRVMLYRFDENNHGDVIAEDKRDDMEPYLGLHYPESDIPQPARRLFIHNPIRVIPDVYGVAVPLTPAVNPSTNRAVDLTESILRSAYHCHLTYLKNMGVGASLTISLIKDGHLWGLIACHHQTPKVIPFELRKACEFFGRVVFSNISAQEDTETFDYRVQLAEHEAVLLDKMTTAADFVEGLTNHPDRLLGLTGSQGAAICFGEKLILVGETPDEKAVQYLLQWLENREVQDVFFTSSLSQIYPDAVNFKSVASGLLAIPIARHNFLLWFRPEVLQTVNWGGDPNHAYEATQKIELHPRQSFDLWK---EIVRLQSLPWQSVEIQSALALKKAIVNLILRQAEEHHHHHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
4.1 22-295 274 1-21, 296-500 21 205 knot
view details
3.2m 21-250 230 1-20 261-500 251-260 20 240 slipknot
view details
4.1 21-262 242 1-20 274-500 263-273 20 227 slipknot
view details
3.2m 21-275 255 1-20 295-500 276-294 20 206 slipknot
view details
3.2m 23-293 271 1-18, 296-500 19-22, 294-295 18 205 slipknot
sequence length 517
structure length 500
publication title The Structure of a Complete Phytochrome Sensory Module in the Pr Ground State.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PHYTOCHROME-LIKE PROTEIN CPH1
source organism Synechocystis sp. pcc 6803
missing residues 70-77, 97-98, 145-148, 460-462
total genus Genus: 137
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-10-18
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00360 PHY Phytochrome region
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling