2VQRA

Crystal structure of a phosphonate monoester hydrolase from rhizobium leguminosarum: a new member of the alkaline phosphatase superfamily
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-322 319 1-3 345-512 323-344 3 168 slipknot
Chain Sequence
KKNVLLIVVDQWRADFVPHVLRADGKIDFLKTPNLDRLCREGVTFRNHVTTCVPXGPARASLLTGLYLMNHRAVQNTVPLDQRHLNLGKALRGVGYDPALIGYTTTVPDPRTTSPNDPRFRVLGDLMDGFHPVGAFEPNMEGYFGWVAQNGFDLPEHRPDIWLPEGEDAVAGATDRPSRIPKEFSDSTFFTERALTYLKGRDGKPFFLHLGYYRPHPPFVASAPYHAMYRPEDMPAPIRAANPDIEAAQHPLMKFYVDSIRRGSFFQGAEGSGATLDEAELRQMRATYCGLITEVDDCLGRVFSYLDETGQWDDTLIIFTSDHGEQLGDHHLLGKIGYNDPSFRIPLVIKDAGENARAGAIESGFTESIDVMPTILDWLGGKIPHACDGLSLLPFLSEGRPQDWRTELHYEYDFRDVYYSEPQSFLGLGMNDCSLCVIQDERYKYVHFAALPPLFFDLRHDPNEFTNLADDPAYAALVRDYAQKALSWRLKHADRTLTHYRSGPEGLSERSH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 4-332 329 1-3 345-512 333-344 3 168 slipknot
sequence length 512
structure length 512
publication title A New Member of the Alkaline Phosphatase Superfamily with a Formylglycine Nucleophile: Structural and Kinetic Characterisation of a Phosphonate Monoester Hydrolase/Phosphodiesterase from Rhizobium Leguminosarum.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PUTATIVE SULFATASE
source organism Rhizobium leguminosarum bv. viciae
total genus Genus: 180
ec nomenclature
pdb deposition date 2008-03-18
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling