2W8SA

Crystal structure of a catalytically promiscuous phosphonate monoester hydrolase from burkholderia caryophylli
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-322 319 1-3 345-512 323-344 3 168 slipknot
Chain Sequence
RKNVLLIVVDQWRADFIPHLMRAEGREPFLKTPNLDRLCREGLTFRNHVTTCVPXGPARASLLTGLYLMNHRAVQNTVPLDQRHLNLGKALRAIGYDPALIGYTTTTPDPRTTSARDPRFTVLGDIMDGFRSVGAFEPNMEGYFGWVAQNGFELPENREDIWLPEGEHSVPGATDKPSRIPKEFSDSTFFTERALTYLKGRDGKPFFLHLGYYRPHPPFVASAPYHAMYKAEDMPAPIRAENPDAEAAQHPLMKHYIDHIRRGSFFHGAEGSGATLDEGEIRQMRATYCGLITEIDDCLGRVFAYLDETGQWDDTLIIFTSDHGEQLGDHHLLGKIGYNAESFRIPLVIKDAGQNRHAGQIEEGFSESIDVMPTILEWLGGETPRACDGRSLLPFLAEGKPSDWRTELHYEFDFRDVFYDQPQNSVQLSQDDCSLCVIEDENYKYVHFAALPPLFFDLKADPHEFSNLAGDPAYAALVRDYAQKALSWRLSHADRTLTHYRSSPQGLTTRNH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 512
structure length 512
publication title An Efficient, Multiply Promiscuous Hydrolase in the Alkaline Phosphatase Superfamily.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PHOSPHONATE MONOESTER HYDROLASE
source organism Burkholderia caryophylli
total genus Genus: 182
ec nomenclature
pdb deposition date 2009-01-19
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling