| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-11-b-24-c-19 | 18-b-31 |
Chain Sequence |
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP
|
| sequence length |
36
|
| structure length |
36
|
| publication title |
Solution Structure of Gxtx-1E, a High Affinity Tarantula Toxin Interacting with Voltage Sensors in Kv2.1 Potassium Channels.
pubmed doi rcsb |
| molecule tags |
Membrane protein inhibitor
|
| molecule keywords |
GUANGXITOXIN-1EGXTX-1E
|
| ec nomenclature | |
| pdb deposition date | 2009-05-02 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
