3BBDA

M. jannaschii nep1 complexed with s-adenosyl-homocysteine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 140-181 42 1-139, 182-204 139 23 knot
Chain Sequence
TYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 140-182 43 1-139, 183-204 139 22 knot
view details
2.1 70-180 111 1-8, 183-204 9-69, 181-182 8 22 slipknot
view details
2.1 135-180 46 1-70, 183-204 71-134, 181-182 70 22 slipknot
sequence length 204
structure length 204
publication title The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Ribosome biogenesis protein NEP1-like
source organism Methanocaldococcus jannaschii
total genus Genus: 64
ec nomenclature
pdb deposition date 2007-11-09
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03587 EMG1 EMG1/NEP1 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
3BBEA 3BBHA
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
3BBE A; 3BBH A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.