| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-17-b-41-c-41 | 3-b-24 |
Chain Sequence |
LECHNQQSSQPPTTKTCSPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
|
| sequence length |
62
|
| structure length |
62
|
| publication title |
Conformational exchange is critical for the productivity of an oxidative folding intermediate with buried free cysteines.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Short neurotoxin 1
|
| ec nomenclature | |
| pdb deposition date | 2010-06-08 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | CD59 | CD59 |
#chains in the KnotProt database with same CATH superfamily 3NDS A; #chains in the KnotProt database with same CATH topology 3NDS A; #chains in the KnotProt database with same CATH homology 3NDS A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
