3K1LA

Crystal structure of fancl
Cysteine knot
Loop Piercing
view details
311-c-314-b-342-c-342 311-b-314
Chain Sequence
EDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHHPALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPE-LCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAALLND
sequence length 377
structure length 376
publication title The structure of the catalytic subunit FANCL of the Fanconi anemia core complex
pubmed doi rcsb
molecule tags Ligase
molecule keywords Fancl
source organism Drosophila melanogaster
missing residues 99
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2009-09-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling