3MFBA

Crystal structure of the s-type pyocin domain of eca1669 protein from erwinia carotovora, northeast structural genomics consortium target ewr82c
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 39-131 93 1-24, 145-150 25-38, 132-144 24 6 slipknot
Chain Sequence
MLLTPEKLLEAANKQGTVPSRVRYQWMEDEETGRLKAVGYHTSMESGRDQVRVRLLKHDFPNNRYEFWEEGATGPTILWTPDNPGIELPTDTAHGEQPVIPSAIPGLEIPEMDDVSILATPMPDEKDFRDYILVFPENAFPPIYVYLSKL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 39-133 95 1-25, 142-150 26-38, 134-141 25 9 slipknot
view details
3.1 35-141 107 1-26, 145-150 27-34, 142-144 26 6 slipknot
view details
3.1 38-141 104 1-34, 143-150 35-37, 142-142 34 8 slipknot
publication title Northeast Structural Genomics Consortium Target EwR82C
rcsb
structure length 150
molecule tags Structural genomics, unknown function
source organism Erwinia carotovora
sequence length 150
total genus Genus: 28
molecule keywords Uncharacterized protein
ec nomenclature
pdb deposition date 2010-04-01
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling