3MLGA

2ouf-2x, a designed knotted protein
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 69
Knot K -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 20-121 102 1-19, 122-169 19 48 knot
Chain Sequence
NPLDKWNDIIFHASKKLSKKELERLLELLALLETFIEKEDLEEKFESFAKALRIDEELQQKIESRKTDIVIQSMANILSG--------GNPLDKWNDIIFHASKKLSKKELERLLELLALLETFIEKEDLEEKFESFAKALRIDEELQQKIESRKTDIVIQSMANILSG
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 13-129 117 1-12 156-161 130-155 12 6 slipknot
view details
2.1m 17-107 91 1-7, 117-161 8-16, 108-116 7 45 slipknot
view details
2.1m 26-121 96 122-161 1-14 15-25 14 39 slipknot
sequence length 169
structure length 161
publication title Structure and folding of a designed knotted protein.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords Putative uncharacterized protein, LINKER, Putative uncharact
source organism Helicobacter pylori, unidentified
missing residues 81-88
total genus Genus: 69
ec nomenclature
pdb deposition date 2010-04-16
KnotProt deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling