3MWRA

Crystal structure of ribonuclease a tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASVSGS--GKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 254
structure length 252
publication title Crystal structure of RNase A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease pancreatic, LINKER, Ribonuclease pancreatic
source organism Bos taurus
missing residues 127-128
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2010-05-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling