3MX8A

Crystal structure of ribonuclease a tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASVGPPGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 252
structure length 252
publication title Crystal structure of RNase A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease pancreatic, LINKER, Ribonuclease pancreatic
source organism Bos taurus
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling