
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 145-189 | 45 | 1-144, 190-216 | 144 | 27 | knot |
Chain Sequence |
MGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 145-191 | 47 | 1-144, 192-216 | 144 | 25 | knot | ||||
view details |
![]() |
2.1 | 143-187 | 45 | 1-142 | 193-216 | 188-192 | 142 | 24 | slipknot | ||
view details |
![]() |
3.1 | 146-191 | 46 | 192-216 | 1-144 | 145-145 | 144 | 24 | slipknot |
sequence length |
216
|
structure length |
216
|
publication title |
Structural insight into the functional mechanism of Nep1/Emg1 N1-specific pseudouridine methyltransferase in ribosome biogenesis.
pubmed doi rcsb |
molecule tags |
Transferase
|
molecule keywords |
Ribosome biogenesis Nep1 RNA methyltransferase
|
source organism |
Archaeoglobus fulgidus
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2010-07-30 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03587 | EMG1 | EMG1/NEP1 methyltransferase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...