3O7BA

Crystal structure of archaeoglobus fulgidus nep1 bound to s-adenosylhomocysteine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 145-189 45 1-144, 190-216 144 27 knot
Chain Sequence
MGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 145-191 47 1-144, 192-216 144 25 knot
view details
2.1 143-187 45 1-142 193-216 188-192 142 24 slipknot
view details
3.1 146-191 46 192-216 1-144 145-145 144 24 slipknot
publication title Structural insight into the functional mechanism of Nep1/Emg1 N1-specific pseudouridine methyltransferase in ribosome biogenesis.
pubmed doi rcsb
structure length 216
molecule tags Transferase
source organism Archaeoglobus fulgidus
sequence length 216
total genus Genus: 75
molecule keywords Ribosome biogenesis Nep1 RNA methyltransferase
ec nomenclature
pdb deposition date 2010-07-30
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03587 EMG1 EMG1/NEP1 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling