| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 36-210 | 175 | 211-436 | 1-21 | 22-35 | 21 | 225 | slipknot | ||
| view details |
 |
41 | 14-244 | 231 | 1-13 | 286-436 | 245-285 | 13 | 151 | slipknot |
Chain Sequence |
ADAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGAIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISP------GLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNPYPLDA
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.2 | 15-237 | 223 | 1-14 | 249-430 | 238-248 | 14 | 182 | slipknot | ||
| view details |
 |
4.1 | 8-248 | 241 | 1-7 | 254-430 | 249-253 | 7 | 177 | slipknot | ||
| view details |
|
3.2 | 21-256 | 236 | 1-6, 281-430 | 7-20, 257-280 | 6 | 150 | slipknot | |||
| view details |
|
3.2 | 23-258 | 236 | 1-20, 279-430 | 21-22, 259-278 | 20 | 152 | slipknot | |||
| view details |
 |
2.1 | 30-201 | 172 | 1-14, 224-430 | 15-29, 202-223 | 14 | 207 | slipknot | |||
| view details |
|
2.1 | 30-223 | 194 | 1-14, 225-430 | 15-29, 224-224 | 14 | 206 | slipknot | |||
| view details |
|
2.1 | 23-224 | 202 | 1-14, 241-430 | 15-22, 225-240 | 14 | 190 | slipknot | |||
| view details |
|
2.1 | 41-287 | 247 | 1-15, 352-430 | 16-40, 288-351 | 15 | 79 | slipknot | |||
| view details |
|
|
2.1 | 40-351 | 312 | 1-15, 428-430 | 16-39, 352-427 | 15 | 3 | slipknot | ||
| view details |
 |
1.1 | 40-225 | 186 | 1-23, 245-430 | 24-39, 226-244 | 23 | 186 | slipknot | |||
| view details |
|
1.1 | 32-198 | 167 | 1-24, 204-430 | 25-31, 199-203 | 24 | 227 | slipknot | |||
| view details |
|
1.1 | 36-222 | 187 | 1-27, 226-430 | 28-35, 223-225 | 27 | 205 | slipknot | |||
| view details |
|
1.1 | 36-200 | 165 | 1-30, 207-430 | 31-35, 201-206 | 30 | 224 | slipknot | |||
| view details |
|
2.1 | 41-202 | 162 | 1-30, 218-430 | 31-40, 203-217 | 30 | 213 | slipknot | |||
| view details |
|
2.1 | 41-217 | 177 | 1-30, 226-430 | 31-40, 218-225 | 30 | 205 | slipknot |
| sequence length |
436
|
| structure length |
430
|
| publication title |
Molecular basis of substrate-induced permeation by an amino acid antiporter.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
AdiC arginine:agmatine antiporter
|
| source organism |
Escherichia coli
|
| missing residues |
341-346
|
| total genus |
 Genus: 164
|
| ec nomenclature | |
| pdb deposition date | 2010-08-06 |
| KnotProt deposition date | 2014-07-31 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
