3OB6A

Structure of adic(n101a) in the open-to-out arg+ bound conformation
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 36-210 175 211-436 1-21 22-35 21 225 slipknot
view details
41 14-244 231 1-13 286-436 245-285 13 151 slipknot
Chain Sequence
ADAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGAIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISP------GLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNPYPLDA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 15-237 223 1-14 249-430 238-248 14 182 slipknot
view details
4.1 8-248 241 1-7 254-430 249-253 7 177 slipknot
view details
3.2 21-256 236 1-6, 281-430 7-20, 257-280 6 150 slipknot
view details
3.2 23-258 236 1-20, 279-430 21-22, 259-278 20 152 slipknot
view details
2.1 30-201 172 1-14, 224-430 15-29, 202-223 14 207 slipknot
view details
2.1 30-223 194 1-14, 225-430 15-29, 224-224 14 206 slipknot
view details
2.1 23-224 202 1-14, 241-430 15-22, 225-240 14 190 slipknot
view details
2.1 41-287 247 1-15, 352-430 16-40, 288-351 15 79 slipknot
view details
2.1 40-351 312 1-15, 428-430 16-39, 352-427 15 3 slipknot
view details
1.1 40-225 186 1-23, 245-430 24-39, 226-244 23 186 slipknot
view details
1.1 32-198 167 1-24, 204-430 25-31, 199-203 24 227 slipknot
view details
1.1 36-222 187 1-27, 226-430 28-35, 223-225 27 205 slipknot
view details
1.1 36-200 165 1-30, 207-430 31-35, 201-206 30 224 slipknot
view details
2.1 41-202 162 1-30, 218-430 31-40, 203-217 30 213 slipknot
view details
2.1 41-217 177 1-30, 226-430 31-40, 218-225 30 205 slipknot
missing residues 341-346
publication title Molecular basis of substrate-induced permeation by an amino acid antiporter.
pubmed doi rcsb
structure length 430
molecule tags Membrane protein
source organism Escherichia coli
sequence length 436
total genus Genus: 164
molecule keywords AdiC arginine:agmatine antiporter
ec nomenclature
pdb deposition date 2010-08-06
KnotProt deposition date 2014-07-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling