Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 57-c-61-b-104-c-102 | 26-b-68 |
Chain Sequence |
HEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKK
|
sequence length |
97
|
structure length |
97
|
publication title |
Design of Synthetic Autonomous VH Domain Libraries and Structural Analysis of a VH Domain Bound to Vascular Endothelial Growth Factor.
pubmed doi rcsb |
molecule tags |
Signaling protein/immune system
|
molecule keywords |
Vascular endothelial growth factor A
|
source organism |
Homo sapiens
|
ec nomenclature | |
pdb deposition date | 2010-10-18 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...