| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 57-c-61-b-104-c-102 | 26-b-68 |
Chain Sequence |
HEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKK
|
| sequence length |
97
|
| structure length |
97
|
| publication title |
Design of Synthetic Autonomous VH Domain Libraries and Structural Analysis of a VH Domain Bound to Vascular Endothelial Growth Factor.
pubmed doi rcsb |
| molecule tags |
Signaling protein/immune system
|
| molecule keywords |
Vascular endothelial growth factor A
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2010-10-18 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
