| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 48-c-52-b-119-c-117 | 19-b-85 |
Chain Sequence |
KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLASHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
|
| sequence length |
105
|
| structure length |
105
|
| publication title |
GDF-5 can act as a context-dependent BMP-2 antagonist.
pubmed doi rcsb |
| molecule tags |
Cytokine/transferase receptor
|
| molecule keywords |
Growth/differentiation factor 5
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2011-01-12 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
