3QSKA

5 histidine variant of the anti-rnase a vhh in complex with rnase a
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSS-----SNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 124
structure length 119
publication title A combinatorial histidine scanning library approach to engineer highly pH-dependent protein switches.
pubmed doi rcsb
molecule tags Hydrolase/immune system
molecule keywords Ribonuclease pancreatic
source organism Camelus dromedarius
missing residues 17-21
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2011-02-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling