3S3XD

Structure of chicken acid-sensing ion channel 1 at 3.0 a resolution in complex with psalmotoxin
Cysteine knot
Loop Piercing
view details
3-c-10-b-23-c-18 17-b-33
Chain Sequence
DCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTP
sequence length 37
structure length 37
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
source organism Gallus gallus
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling