| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-10-b-23-c-18 | 17-b-33 |
Chain Sequence |
DCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTP
|
| sequence length |
37
|
| structure length |
37
|
| publication title |
Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
Amiloride-sensitive cation channel 2, neuronal
|
| source organism |
Gallus gallus
|
| ec nomenclature | |
| pdb deposition date | 2011-05-18 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
