Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 25-262 | 238 | 1-24, 263-266 | 24 | 4 | knot |
Chain Sequence |
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSYT
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 3.1 | 10-264 | 255 | 1-9, 265-266 | 9 | 2 | knot | |||||
view details | 2.1 | 25-260 | 236 | 1-24 | 265-266 | 261-264 | 24 | 2 | slipknot | |||
view details | 3.1 | 25-264 | 240 | 265-266 | 1-9 | 10-24 | 9 | 1 | slipknot |
sequence length |
266
|
structure length |
266
|
publication title |
A complex between contactin-1 and the protein tyrosine phosphatase PTPRZ controls the development of oligodendrocyte precursor cells.
pubmed doi rcsb |
molecule tags |
Cell adhesion
|
molecule keywords |
Receptor-type tyrosine-protein phosphatase zeta
|
source organism |
Homo sapiens
|
total genus |
Genus: 77
|
ec nomenclature |
ec
3.1.3.48: Protein-tyrosine-phosphatase. |
pdb deposition date | 2011-05-31 |
KnotProt deposition date | 2014-10-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...