| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 43-c-47-b-108-c-106 | 15-b-74 |
Chain Sequence |
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
|
| sequence length |
109
|
| structure length |
109
|
| publication title |
Structure of myostatinfollistatin-like 3: N-terminal domains of follistatin-type molecules exhibit alternate modes of binding.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Growth/differentiation factor 8
|
| source organism |
Mus musculus
|
| ec nomenclature | |
| pdb deposition date | 2011-06-10 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
