3SIJA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase e115a mutant from thermomonospora curvata
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 56-253 198 1-55, 254-274 55 21 knot
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEG---------TRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEAGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 56-245 190 1-55, 246-265 55 20 knot
view details
2.1 15-244 230 1-14 249-265 245-248 14 17 slipknot
view details
2.1 25-244 220 1-16, 246-265 17-24, 245-245 16 20 slipknot
sequence length 274
structure length 265
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords poly(ADP-ribose) glycohydrolase
source organism Thermomonospora curvata
missing residues 56-64
total genus Genus: 89
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
3SIGA 3SIHA 5ZDAA 5ZDBA 5ZDCC 5ZDDA 5ZDFA 5ZDGC
similar chains in the KnotProt database (40% sequence similarity)
3SIIA
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
3SIG A; 
#similar chains, but unknotted
5ZDG C; 
#similar chains in the pdb database (40% sequence similarity)
3SII A; 

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.