3SNFA

Onconase, atomic resolution crystal structure
Cysteine knot
Loop Piercing
view details
30-c-48-b-90-c-75 19-b-68
Chain Sequence
EDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC
sequence length 104
structure length 104
publication title Crystal structure of Onconase at 1.1 angstrom resolution--insights into substrate binding and collective motion.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Protein P-30
ec nomenclature ec 3.1.27.-:
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling