| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 41-c-59-b-111-c-96 | 27-b-85 |
Chain Sequence |
RESAAQKFQRQHMDPDGSSINSPTYCNQMMKRRDMTNGSCKPVNTFVHEPLADVQAVCSQENVTCKNRKSNCYKSSSALHITDCHLKGNSKYPNCDYKTTQYQKHIIVACEGNPYVPVHFDATV
|
| sequence length |
124
|
| structure length |
124
|
| publication title |
Functional evolution of ribonuclease inhibitor: insights from birds and reptiles.
pubmed doi rcsb |
| molecule tags |
Hydrolase/hydrolase inhibitor
|
| molecule keywords |
Ribonuclease pancreatic
|
| source organism |
Mus musculus
|
| ec nomenclature |
ec
3.1.27.5: Pancreatic ribonuclease. |
| pdb deposition date | 2011-09-13 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...