| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 30-c-48-b-90-c-75 | 19-b-68 |
Chain Sequence |
EDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC
|
| sequence length |
104
|
| structure length |
104
|
| publication title |
Crystal structure of wild-type onconase at 1.65 A resolution
rcsb |
| molecule tags |
Hydrolase, antitumor protein
|
| molecule keywords |
Protein P-30
|
| source organism |
Rana pipiens
|
| ec nomenclature |
ec
3.1.27.-: |
| pdb deposition date | 2011-09-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
