3USIA

Crystal structure of leut bound to l-leucine in space group p2 from lipid bicelles
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 200
Slipknot S +31 41 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 37-261 225 262-509 1-19 20-36 19 247 slipknot
view details
41 13-297 285 1-12 347-509 298-346 12 163 slipknot
Chain Sequence
REHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPKTHW----TVWITRFYIIGLFLFLTFLVFLAERRRNHESA
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 11-286 276 1-10 298-502 287-297 10 205 slipknot
view details
4.1 11-301 291 1-10 312-502 302-311 10 191 slipknot
view details
3.2 7-317 311 1-6 323-502 318-322 6 180 slipknot
view details
3.2 12-330 319 1-11 347-502 331-346 11 156 slipknot
view details
4.1 8-322 315 1-3, 328-502 4-7, 323-327 3 175 slipknot
view details
4.1 12-309 298 1-5, 318-502 6-11, 310-317 5 185 slipknot
view details
3.2 11-317 307 1-6, 319-502 7-10, 318-318 6 184 slipknot
view details
2.1 36-253 218 1-17, 268-502 18-35, 254-267 17 235 slipknot
view details
2.1 35-420 386 1-19, 467-502 20-34, 421-466 19 36 slipknot
view details
1.1 35-244 210 1-20, 253-502 21-34, 245-252 20 250 slipknot
view details
2.1 41-405 365 406-502 1-20 21-40 20 96 slipknot
view details
1.1 28-272 245 1-21, 277-502 22-27, 273-276 21 226 slipknot
view details
2.1 44-353 310 1-22, 400-502 23-43, 354-399 22 103 slipknot
view details
1.1 32-252 221 1-25, 254-502 26-31, 253-253 25 249 slipknot
view details
1.1 41-276 236 1-29, 291-502 30-40, 277-290 29 212 slipknot
view details
3.1 37-262 226 1-35, 268-502 36-36, 263-267 35 235 slipknot
view details
2.1 37-267 231 1-31, 270-502 32-36, 268-269 31 233 slipknot
view details
1.1 37-250 214 1-32, 256-502 33-36, 251-255 32 247 slipknot
sequence length 509
structure length 502
publication title Structures of LeuT in bicelles define conformation and substrate binding in a membrane-like context.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus
missing residues 128-130, 471-474
total genus Genus: 200
ec nomenclature
pdb deposition date 2011-11-23
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling