3USPA

Crystal structure of leut in heptyl-beta-d-selenoglucoside
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 212
Slipknot S +31 41 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 39-264 226 265-511 1-21 22-38 21 246 slipknot
view details
41 13-293 281 1-12 349-511 294-348 12 163 slipknot
Chain Sequence
REHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPPP--TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYET------HWTVWITRFYIIGLFLFLTFLVFLAERRRNHESAGT
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 11-287 277 1-10 300-503 288-299 10 204 slipknot
view details
4.1 13-299 287 1-12 312-503 300-311 12 192 slipknot
view details
4.1 7-317 311 1-6 324-503 318-323 6 180 slipknot
view details
3.2 14-333 320 1-13 349-503 334-348 13 155 slipknot
view details
2.1 24-483 460 1-15, 500-503 16-23, 484-499 15 4 slipknot
view details
1.1 22-271 250 1-16, 285-503 17-21, 272-284 16 219 slipknot
view details
2.1 32-254 223 1-18, 266-503 19-31, 255-265 18 238 slipknot
view details
3.1 26-265 240 1-18, 272-503 19-25, 266-271 18 232 slipknot
view details
2.1 26-271 246 1-21, 274-503 22-25, 272-273 21 230 slipknot
view details
2.1 35-419 385 1-18, 466-503 19-34, 420-465 18 38 slipknot
view details
2.1 34-244 211 1-20, 254-503 21-33, 245-253 20 250 slipknot
view details
2.1 34-253 220 1-21, 257-503 22-33, 254-256 21 247 slipknot
view details
2.1 29-467 439 1-20, 474-503 21-28, 468-473 20 30 slipknot
view details
2.1 41-354 314 1-21, 401-503 22-40, 355-400 21 103 slipknot
view details
1.1 41-275 235 1-28, 291-503 29-40, 276-290 28 213 slipknot
view details
3.1 41-260 220 1-32, 276-503 33-40, 261-275 32 228 slipknot
sequence length 511
structure length 503
publication title Structures of LeuT in bicelles define conformation and substrate binding in a membrane-like context.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus
missing residues 129-130, 468-473
total genus Genus: 212
ec nomenclature
pdb deposition date 2011-11-23
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling