| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 57-c-61-b-104-c-102 | 26-b-68 |
Chain Sequence |
TKGWSEVLKGSECKPRPIVVPVSETHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEVNVTMELLGASGSGSNGMQRLSFVEHKKCDCRPR
|
| sequence length |
94
|
| structure length |
94
|
| publication title |
Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb |
| molecule tags |
Hormone/signaling protein
|
| molecule keywords |
VEGF-E
|
| source organism |
Orf virus
|
| ec nomenclature | |
| pdb deposition date | 2011-12-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
