3W6HA

Crystal structure of 19f probe-labeled hcai in complex with acetazolamide
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 21-253 233 1-20, 254-256 20 2 slipknot
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-253 231 254-256 1-2 3-22 2 2 slipknot
Fingerprint Knot forming loop Loop type
K +31 Trp5 ... His94 <->
Bridging ionZn302
<-> His96 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His96 <->
Bridging ionZn302
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His94 <->
Bridging ionZn302
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 22-251 230 1-21, 252-256 21 5 knot
view details
3.1 23-254 232 255-256 1-21 22-22 21 1 slipknot
sequence length 256
structure length 256
publication title Quantitative Comparison of Protein Dynamics in Live Cells and In Vitro by In-Cell 19F-NMR
rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 1
source organism Homo sapiens
total genus Genus: 67
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2013-02-14
KnotProt deposition date 2018-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling