| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 74-137 | 64 | 1-73 | 142-162 | 138-141 | 73 | 21 | slipknot |
Chain Sequence |
LPVLEIASNSQ------VCSGTLQKTEDVHLMGFTLSGQKVADSPLEASKRWAFRTGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPSNIRDYPKCKTVHHIQGQNPHAQGIALHLWGAFFLYDRVASTTMYRGKVFTEGNIAAMIVNKTVHRMIFS
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 68-129 | 62 | 1-67 | 138-156 | 130-137 | 67 | 19 | slipknot | ||
| view details |
|
1.1 | 74-130 | 57 | 1-67, 137-156 | 68-73, 131-136 | 67 | 20 | slipknot |
| sequence length |
162
|
| structure length |
156
|
| publication title |
Structural basis for Marburg virus neutralization by a cross-reactive human antibody
rcsb |
| molecule tags |
Viral protein/immune system
|
| molecule keywords |
Envelope glycoprotein GP1
|
| source organism |
Ravn virus - ravn, kenya, 1987
|
| missing residues |
12-17
|
| ec nomenclature | |
| pdb deposition date | 2014-12-20 |
| KnotProt deposition date | 2015-02-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...