3X2DA

Crystal structure of marburg virus gp in complex with the human survivor antibody mr78
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 74-137 64 1-73 142-162 138-141 73 21 slipknot
Chain Sequence
LPVLEIASNSQ------VCSGTLQKTEDVHLMGFTLSGQKVADSPLEASKRWAFRTGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPSNIRDYPKCKTVHHIQGQNPHAQGIALHLWGAFFLYDRVASTTMYRGKVFTEGNIAAMIVNKTVHRMIFS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 68-129 62 1-67 138-156 130-137 67 19 slipknot
view details
1.1 74-130 57 1-67, 137-156 68-73, 131-136 67 20 slipknot
missing residues 12-17
publication title Structural basis for Marburg virus neutralization by a cross-reactive human antibody
rcsb
structure length 156
molecule tags Viral protein/immune system
source organism Ravn virus - ravn, kenya, 1987
sequence length 162
molecule keywords Envelope glycoprotein GP1
ec nomenclature
pdb deposition date 2014-12-20
KnotProt deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling