3ZBWB

Crystal structure of murine angiogenin-3
Cysteine knot
Loop Piercing
view details
39-c-57-b-106-c-91 26-b-80
Chain Sequence
QDNYRYIKFLTQHYDAKPTGRDYRYCESMMKKRKLTSPCKEVNTFIHDTKNNIKAICGENGNPYGVNFRISNSRFQVTTCTHKGGSPRPPCQYNAFKDFRYIVIACEDGWPVHFDESFISP
sequence length 121
structure length 121
publication title Crystal Structures of Murine Angiogenin-2 and -3 - Probing 'Structure - Function' Relationships Amongst Angiogenin Homologues.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ANGIOGENIN-3
source organism Mus musculus
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-11-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling