4FMWA

Crystal structure of methyltransferase domain of human rna (guanine-9-) methyltransferase domain containing protein 2
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 93-136 44 1-92, 137-182 92 46 knot
Chain Sequence
RDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFV----RKVLAVNHVFEIILEYLETRDWQEAFFTILPQR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 92-138 47 1-91, 139-178 91 40 knot
view details
2.1 90-134 45 1-89 140-178 135-139 89 39 slipknot
sequence length 182
structure length 178
publication title Crystal structure of methyltransferase domain of human RNA (guanine-9-) methyltransferase domain containing protein 2
rcsb
molecule tags Transferase
molecule keywords RNA (guanine-9-)-methyltransferase domain-containing protein
source organism Homo sapiens
missing residues 146-149
total genus Genus: 58
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-06-18
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.