4JSAA

Benzenesulfonamide complexed with hcaii h94d
Genus: 76
Alphaknot: P00918
Slipknot S +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-254 231 1-23, 255-258 23 4 knot
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 23x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 20-254 235 1-19, 255-258 19 4 knot
Fingerprint Knot forming loop Loop type
K +31 His4 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Val135 <->
Bridging ionMbo302
<-> Glu205 ...
Chain closureLys261 <-> His4
 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His4		 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Gln137 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Cys206 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ... Val135 <->
Bridging ionMbo302
<-> Glu205 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Glu205 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ... Val135 <->
Bridging ionMbo302
<-> Glu205 ...
Chain closureLys261 <-> His4
 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His96 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> His96 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His96 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> His96 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-256 231 1-25, 257-257 25 1 knot
view details
2.1 25-251 227 1-24 257-257 252-256 24 1 slipknot
sequence length 257
structure length 257
publication title Metalloprotein-Inhibitor Binding: Human Carbonic Anhydrase II as a Model for Probing Metal-Ligand Interactions in a Metalloprotein Active Site.
pubmed doi rcsb
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
total genus Genus: 76
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2013-03-22
KnotProt deposition date 2018-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling