
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 7-327 | 321 | 1-6 | 343-391 | 328-342 | 6 | 49 | slipknot |
Chain Sequence |
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
|
![]() |
3.1 | 8-329 | 322 | 1-7 | 338-391 | 330-337 | 7 | 54 | slipknot | |
view details |
|
![]() |
2.1 | 5-340 | 336 | 1-4 | 346-391 | 341-345 | 4 | 46 | slipknot |
sequence length |
391
|
structure length |
391
|
publication title |
Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb |
molecule tags |
Isomerase
|
molecule keywords |
Phosphopentomutase
|
source organism |
Bacillus cereus
|
total genus |
![]() |
ec nomenclature |
ec
5.4.2.7: Phosphopentomutase. |
pdb deposition date | 2013-07-19 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01676 | Metalloenzyme | Metalloenzyme superfamily |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...