| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 89-133 | 45 | 1-88, 134-249 | 88 | 116 | knot |
Chain Sequence |
GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--ASASF---ADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 89-134 | 46 | 1-88, 135-244 | 88 | 110 | knot | ||||
| view details |
 |
2.1 | 86-131 | 46 | 1-85 | 137-244 | 132-136 | 85 | 108 | slipknot | ||
| view details |
|
|
3.1 | 91-215 | 125 | 1-88, 237-244 | 89-90, 216-236 | 88 | 8 | slipknot | ||
| view details |
|
|
2.1 | 91-236 | 146 | 237-244 | 1-88 | 89-90 | 88 | 7 | slipknot |
| sequence length |
249
|
| structure length |
244
|
| publication title |
Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb |
| molecule tags |
Transferase/transferase inhibitor
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
|
| missing residues |
165-166, 170-172
|
| total genus |
 Genus: 70
|
| ec nomenclature | |
| pdb deposition date | 2015-03-13 |
| KnotProt deposition date | 2015-11-11 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
