4AHLA

P112l - angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis
Cysteine knot
Loop Piercing
view details
39-c-57-b-107-c-92 26-b-81
Chain Sequence
SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR
sequence length 119
structure length 119
publication title Structural and Molecular Insights Into the Mechanism of Action of Human Angiogenin-Als Variants in Neurons.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ANGIOGENIN
source organism Homo sapiens
ec nomenclature ec 3.1.27.-:
pdb deposition date 2012-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling