4B2UA

S67, a spider venom toxin peptide from sicarius dolichocephalus
Cysteine knot
Loop Piercing
view details
4-c-11-b-24-c-21 20-b-33
Chain Sequence
GTYCIELGERCPNPREGDWCCHKCVPEGKRFYCRDQ
sequence length 36
structure length 36
publication title Solution Structures of Two Homologous Venom Peptides from Sicarius Dolichocephalus.
pubmed doi rcsb
molecule tags Toxin
molecule keywords S67
source organism Sicarius dolichocephalus
ec nomenclature
pdb deposition date 2012-07-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling