4BW5A

Crystal structure of human two pore domain potassium ion channel trek2 (k2p10.1)
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 24x -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 96-240 145 1-95, 241-261 95 21 knot
Fingerprint Knot forming loop Loop type
K -31 Lys73 ... Thr172 <->
Bridging ionK602
<-> Val282 ... Ile173 <->
Bridging ionK601
<-> Gly283 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Lys73 ... Thr172 <->
Bridging ionK602
<-> Val282 ... Tyr175 <->
Bridging ionK600
<-> Gly283 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Lys73 ... Thr172 <->
Bridging ionK602
<-> Thr281 ... Ile173 <->
Bridging ionK601
<-> Gly283 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Lys73 ... Thr172 <->
Bridging ionK602
<-> Thr281 ... Tyr175 <->
Bridging ionK600
<-> Gly283 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Thr172 <->
Bridging ionK602
<-> Val282 ... Thr281 <->
Bridging ionK602
<-> Thr172		 ion-based
K -31 Tyr175 ... Gly283 <->
Bridging ionK600
<-> Tyr175		 ion-based
K -31 Thr172 ... Gly174 <->
Bridging ionK600
<-> Gly283 ... Val282 <->
Bridging ionK602
<-> Thr172		 ion-based
K -31 Gly174 ... Gly283 <->
Bridging ionK600
<-> Gly174		 ion-based
K -31 Lys73 ... Ile173 <->
Bridging ionK601
<-> Gly283 ... Tyr175 <->
Bridging ionK600
<-> Phe284 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Thr172 <->
Bridging ionK602
<-> Val282 ... Tyr175 <->
Bridging ionK600
<-> Phe284 ... Gly283 <->
Bridging ionK601
<-> Ile173 ... Thr172		 ion-based
K -31 Thr172 <->
Bridging ionK602
<-> Val282 ... Phe284 <->
Bridging ionK600
<-> Tyr175 ... Thr281 <->
Bridging ionK602
<-> Thr172		 ion-based
K -31 Lys73 ... Gly174 <->
Bridging ionK600
<-> Phe284 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Ile173 ... Gly174 <->
Bridging ionK600
<-> Phe284 ... Gly283 <->
Bridging ionK601
<-> Ile173		 ion-based
K -31 Thr172 <->
Bridging ionK602
<-> Val282 ... Phe284 <->
Bridging ionK600
<-> Gly174 ... Thr281 <->
Bridging ionK602
<-> Thr172		 ion-based
K -31 Lys73 ... Gly174 <->
Bridging ionK600
<-> Gly283 ... Tyr175 <->
Bridging ionK600
<-> Phe284 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Lys73 ... Thr172 <->
Bridging ionK602
<-> Thr281 ... Gly283 <->
Bridging ionK600
<-> Gly174 ... Tyr175 <->
Bridging ionK600
<-> Phe284 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Gly174 <->
Bridging ionK600
<-> Gly283 ... Phe284 <->
Bridging ionK600
<-> Tyr175 ... Gly174		 ion-based
K -31 Lys73 ... Ile173 <->
Bridging ionK602
<-> Val282 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Thr172 <->
Bridging ionK602
<-> Thr281 ... Val282 <->
Bridging ionK602
<-> Ile173 ... Thr172		 ion-based
K -31 Thr172 <->
Bridging ionK602
<-> Thr281 ... Tyr175 <->
Bridging ionK600
<-> Phe284 ... Val282 <->
Bridging ionK602
<-> Ile173 ... Thr172		 ion-based
K -31 Thr172 <->
Bridging ionK602
<-> Thr281 ... Gly174 <->
Bridging ionK600
<-> Phe284 ... Val282 <->
Bridging ionK602
<-> Ile173 ... Thr172		 ion-based
K -31 Lys73 ... Gly174 <->
Bridging ionK601
<-> Val282 ... Tyr175 <->
Bridging ionK600
<-> Gly283 ...
Chain closureSer331 <-> Lys73
 probabilistic
K -31 Thr172 ... Gly174 <->
Bridging ionK601
<-> Val282 ... Gly283 <->
Bridging ionK600
<-> Tyr175 ... Thr281 <->
Bridging ionK602
<-> Thr172		 ion-based
K -31 Gly174 <->
Bridging ionK600
<-> Gly283 ... Val282 <->
Bridging ionK601
<-> Gly174		 ion-based
Chain Sequence
KWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIG----NSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKIRVI-------STILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLS
sequence length 259
structure length 248
publication title K2P Channel Gating Mechanisms Revealed by Structures of Trek-2 and a Complex with Prozac
pubmed doi rcsb
molecule tags Transport protein
molecule keywords POTASSIUM CHANNEL SUBFAMILY K MEMBER 10
source organism Homo sapiens
missing residues 77-80, 157-163
total genus Genus: 85
ec nomenclature
pdb deposition date 2013-06-30
KnotProt deposition date 2018-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling