| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 83-136 | 54 | 1-82, 137-169 | 82 | 33 | knot |
Chain Sequence |
DPALRALQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 83-136 | 54 | 1-82, 137-169 | 82 | 33 | knot | ||||
| view details |
 |
2.1 | 50-133 | 84 | 1-49 | 140-169 | 134-139 | 49 | 30 | slipknot |
| sequence length |
169
|
| structure length |
169
|
| publication title |
Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
TRNA (CYTIDINE/URIDINE-2'-O-)-METHYLTRANSFERASE TRMJ
|
| source organism |
Escherichia coli
|
| total genus |
 Genus: 56
|
| ec nomenclature |
ec
2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase. |
| pdb deposition date | 2014-01-22 |
| KnotProt deposition date | 2014-09-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00588 | SpoU_methylase | SpoU rRNA Methylase family |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
