
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 83-135 | 53 | 1-82, 136-169 | 82 | 34 | knot |
Chain Sequence |
DPALRALQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 83-137 | 55 | 1-82, 138-169 | 82 | 32 | knot | ||||
view details |
![]() |
2.1 | 80-133 | 54 | 1-79 | 140-169 | 134-139 | 79 | 30 | slipknot | ||
view details |
![]() |
2.1 | 85-145 | 61 | 1-82, 169-169 | 83-84, 146-168 | 82 | 1 | slipknot |
sequence length |
169
|
structure length |
169
|
publication title |
Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb |
molecule tags |
Transferase
|
molecule keywords |
TRNA (CYTIDINE/URIDINE-2'-O-)-METHYLTRANSFERASE TRMJ
|
source organism |
Escherichia coli
|
total genus |
![]() |
ec nomenclature |
ec
2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase. |
pdb deposition date | 2014-01-22 |
KnotProt deposition date | 2014-09-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00588 | SpoU_methylase | SpoU rRNA Methylase family |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...