4CPAI

Refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution
Cysteine knot
Loop Piercing
view details
8-c-12-b-27-c-24 18-b-34
Chain Sequence
XHADPICNKPCKTHDDCSGAWFCQACWNSARTCGPYV
sequence length 37
structure length 37
publication title Refined crystal structure of the potato inhibitor complex of carboxypeptidase A at 2.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase (c-terminal peptidase)
molecule keywords CARBOXYPEPTIDASE A
source organism Bos taurus
ec nomenclature
pdb deposition date 1982-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling