4EC7B

Cobra ngf in complex with lipid
Cysteine knot
Loop Piercing
view details
56-c-66-b-108-c-106 14-b-78
Chain Sequence
GEHSVCDSVSAWVTKTTATDIKGNTVTVMENVNLDNKVYKEYFFETKCKNPNPEPSGCRGIDSSHWNSYCTETDTFIKALTMEGNQASWRFIRIETACVCVITKKKGN
sequence length 108
structure length 108
publication title Structural and functional insights into lipid-bound nerve growth factors
pubmed doi rcsb
molecule tags Hormone
molecule keywords Venom nerve growth factor
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling