4ETQC

Vaccinia virus d8l imv envelope protein in complex with fab of murine igg2a la5
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-231 228 1-3, 232-233 3 2 knot
Chain Sequence
QQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVLDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADAVWIIFPTPINIHSDQLSKFRTLLSL--------YITENYRNPYKLNDDTEVYYSG
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 4-222 219 1-3, 223-225 3 3 knot
sequence length 233
structure length 225
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
molecule tags Immune system/viral protein
molecule keywords anti-vaccinia D8L antigen murine monoclonal IgG2a antibody L
source organism Mus musculus
missing residues 204-211
total genus Genus: 59
ec nomenclature
pdb deposition date 2012-04-24
KnotProt deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
4ETQC 5USHA 5USLA
similar chains in the KnotProt database (40% sequence similarity)
6B9JX
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
4ETQ C; 
#similar chains, but unknotted
5USL A; 
#similar chains in the pdb database (40% sequence similarity)
6B9J X; 

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.