4FAOB

Specificity and structure of a high affinity activin-like 1 (alk1) signaling complex
Cysteine knot
Loop Piercing
view details
37-c-41-b-109-c-107 8-b-74
Chain Sequence
SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
sequence length 105
structure length 105
publication title Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.
pubmed doi rcsb
molecule tags Signaling protein/signaling protein
molecule keywords Growth/differentiation factor 2
source organism Homo sapiens
ec nomenclature
pdb deposition date 2012-05-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling