Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 93-136 | 44 | 1-92, 137-182 | 92 | 46 | knot |
Chain Sequence |
RDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFV----RKVLAVNHVFEIILEYLETRDWQEAFFTILPQR
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 92-138 | 47 | 1-91, 139-178 | 91 | 40 | knot | ||||
view details |
![]() |
2.1 | 90-134 | 45 | 1-89 | 140-178 | 135-139 | 89 | 39 | slipknot |
sequence length |
182
|
structure length |
178
|
publication title |
Crystal structure of methyltransferase domain of human RNA (guanine-9-) methyltransferase domain containing protein 2
rcsb |
molecule tags |
Transferase
|
molecule keywords |
RNA (guanine-9-)-methyltransferase domain-containing protein
|
source organism |
Homo sapiens
|
missing residues |
146-149
|
total genus |
![]() |
ec nomenclature |
ec
2.1.1.-: |
pdb deposition date | 2012-06-18 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...