| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-10-b-23-c-18 | 17-b-33 |
Chain Sequence |
DCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTP
|
| sequence length |
37
|
| structure length |
37
|
| publication title |
Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes.
pubmed doi rcsb |
| molecule tags |
Transport protein
|
| molecule keywords |
Acid-sensing ion channel 1
|
| source organism |
Gallus gallus
|
| ec nomenclature | |
| pdb deposition date | 2012-07-05 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
