| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-221 | 198 | 1-23, 222-224 | 23 | 3 | knot |
Chain Sequence |
EWSYEGEKGPEHWAQLKPEFFWCKLKNQSPINIDKKYKVKANLPKLNLYYKTAKESEVVNNGHTIQINIKEDNTLNYLGEKYQLKQFHFHTPSEHTIEKKSYPLEIHFVHKTEDGKILVVGVMAKLGKTNKELDKILNVAPAEEGEKILDKNLNLNNLIPKDKRYMTYSGSLTTPPCTEGVRWIVLKKPISISKQQLEKLKSVMVNPNNRPVQEINSRWIIEGF
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 27-205 | 179 | 206-207 | 1-1 | 2-26 | 1 | 1 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Glu2 ... His89 <-> Bridging ionZn301 <-> His108 ... Chain closurePhe225 <-> Glu2 |
probabilistic | |||
|
|
K +31 | Glu2 ... His91 <-> Bridging ionZn301 <-> His108 ... Chain closurePhe225 <-> Glu2 |
probabilistic | |||
|
|
K +31 | Glu2 ... His89 <-> Bridging ionZn301 <-> His91 ... Chain closurePhe225 <-> Glu2 |
probabilistic |
Chain Sequence |
EWSYEGEKGPEHWAQLKPEFFWCKLKNQSPINIDKKYKVKANLPKLNLYYKTAKESEVVNNGHTIQINIKEDNTLNYLGEKYQLKQFHFHTPSEHTIEKKSYPLEIHFVHKTEDGKILVVGVMAKLGKTNKELDKILNVAPAEEGEKILDKNLNLNNLIPKDKRYMTYSGSLTTPPCTEGVRWIVLKKPISISKQQLEKLKSVMVNPNNRPVQEINSRWIIEGF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 27-219 | 193 | 1-26 | 224-224 | 220-223 | 26 | 1 | slipknot |
| sequence length |
224
|
| structure length |
224
|
| publication title |
X-ray structure of the first `extremo-{alpha}-carbonic anhydrase', a dimeric enzyme from the thermophilic bacterium Sulfurihydrogenibium yellowstonense YO3AOP1.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonate dehydratase
|
| source organism |
Sulfurihydrogenibium sp. yo3aop1
|
| total genus |
 Genus: 61
|
| ec nomenclature |
ec
4.2.1.1: Carbonate dehydratase. |
| pdb deposition date | 2012-07-20 |
| KnotProt deposition date | 2018-10-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
