4G7AA

The crystal structure of an alpha carbonic anhydrase from the extremophilic bacterium sulfurihydrogenibium yellowstonense yo3aop1
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-221 198 1-23, 222-224 23 3 knot
Chain Sequence
EWSYEGEKGPEHWAQLKPEFFWCKLKNQSPINIDKKYKVKANLPKLNLYYKTAKESEVVNNGHTIQINIKEDNTLNYLGEKYQLKQFHFHTPSEHTIEKKSYPLEIHFVHKTEDGKILVVGVMAKLGKTNKELDKILNVAPAEEGEKILDKNLNLNNLIPKDKRYMTYSGSLTTPPCTEGVRWIVLKKPISISKQQLEKLKSVMVNPNNRPVQEINSRWIIEGF
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 27-205 179 206-207 1-1 2-26 1 1 slipknot
Fingerprint Knot forming loop Loop type
K +31 Glu2 ... His89 <->
Bridging ionZn301
<-> His108 ...
Chain closurePhe225 <-> Glu2
probabilistic
K +31 Glu2 ... His91 <->
Bridging ionZn301
<-> His108 ...
Chain closurePhe225 <-> Glu2
probabilistic
K +31 Glu2 ... His89 <->
Bridging ionZn301
<-> His91 ...
Chain closurePhe225 <-> Glu2
probabilistic
Chain Sequence
EWSYEGEKGPEHWAQLKPEFFWCKLKNQSPINIDKKYKVKANLPKLNLYYKTAKESEVVNNGHTIQINIKEDNTLNYLGEKYQLKQFHFHTPSEHTIEKKSYPLEIHFVHKTEDGKILVVGVMAKLGKTNKELDKILNVAPAEEGEKILDKNLNLNNLIPKDKRYMTYSGSLTTPPCTEGVRWIVLKKPISISKQQLEKLKSVMVNPNNRPVQEINSRWIIEGF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 27-219 193 1-26 224-224 220-223 26 1 slipknot
publication title X-ray structure of the first `extremo-{alpha}-carbonic anhydrase', a dimeric enzyme from the thermophilic bacterium Sulfurihydrogenibium yellowstonense YO3AOP1.
pubmed doi rcsb
structure length 224
molecule tags Lyase
source organism Sulfurihydrogenibium sp. yo3aop1
sequence length 224
total genus Genus: 61
molecule keywords Carbonate dehydratase
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2012-07-20
KnotProt deposition date 2018-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling